| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CDK5 Activator 1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CDK5 Activator 1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CDK5 Activator 1. This antibody reacts with human. The CDK5 Activator 1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human CDK5 Activator 1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDK |
|---|
| Other Names | CDK5 activator 1, CDK5P35, CDK5R, cyclin-dependent kinase 5 activator 1, Cyclin-dependent kinase 5 regulatory subunit 1, cyclin-dependent kinase 5, regulatory subunit 1 (p35), MGC33831, NCK5A, neuronal CDK5 activator, p23, p25, p35, p35nck5a, regulatory partner for CDK5 kinase, tau protein kinase II 23kDa subunit, TPKII regulatory subunit |
|---|
| Gene, Accession # | CDK5R1, Gene ID: 8851 |
|---|
| Catalog # | NBP2-55112 |
|---|
| Price | |
|---|
| Order / More Info | CDK5 Activator 1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|