| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CDKL1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CDKL1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CDKL1. This antibody reacts with human. The CDKL1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human CDKL1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TLRKSRKHHCFTETSKLQYLPQLTGSSILPALDNKKYYCDTKKLNY |
|---|
| Other Names | CDC2-related kinase 1, cyclin-dependent kinase-like 1, cyclin-dependent kinase-like 1 (CDC2-related kinase), EC 2.7.11, EC 2.7.11.22, KKIALRE, P42, Protein kinase p42 KKIALRE, serine/threonine protein kinase KKIALRE, Serine/threonine-protein kinase KKIALRE |
|---|
| Gene, Accession # | CDKL1, Gene ID: 8814 |
|---|
| Catalog # | NBP2-57291 |
|---|
| Price | |
|---|
| Order / More Info | CDKL1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|