| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NUDT2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NUDT2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NUDT2. This antibody reacts with human. The NUDT2 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human NUDT2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALR |
|---|
| Other Names | Ap4A hydrolase, Ap4A hydrolase 1, Ap4Aase, APAH1Diadenosine 5'-5'''-P1, bis(5'-nucleosyl)-tetraphosphatase (asymmetrical), bis(5'-nucleosyl)-tetraphosphatase [asymmetrical], diadenosine 5'-5''-P1, Diadenosine tetraphosphatase, EC 3.6.1.17, MGC10404, Nucleoside diphosphate-linked moiety X motif 2, nudix (nucleoside diphosphate linked moiety X)-type motif 2, Nudix motif 2, P4-tetraphosphate asymmetrical hydrolase, P4-tetraphosphate pyrophosphohydrolase |
|---|
| Gene, Accession # | NUDT2, Gene ID: 318 |
|---|
| Catalog # | NBP2-49521 |
|---|
| Price | |
|---|
| Order / More Info | NUDT2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|