| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | APRIN |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The APRIN Antibody from Novus Biologicals is a rabbit polyclonal antibody to APRIN. This antibody reacts with human. The APRIN Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human APRIN antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ESPESSAIESTQSTPQKGRGRPSKTPSPSQPKKNVRVGRSKQAATKENDSSEEVDVFQGSSPVDDIPQEETEEEEVSTVNVRRRSAKRER |
|---|
| Other Names | Androgen-induced proliferation inhibitorKIAA0979androgen induced inhibitor of proliferation, Androgen-induced prostate proliferative shutoff-associated protein AS3, androgen-induced shutoff 3, AS3APRIN, CG008, FLJ23236, PDS5, regulator of cohesion maintenance, homolog B (S. cerevisiae), sister chromatid cohesion protein PDS5 homolog B |
|---|
| Gene, Accession # | PDS5B, Gene ID: 23047 |
|---|
| Catalog # | NBP1-90121 |
|---|
| Price | |
|---|
| Order / More Info | APRIN Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|