| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ENTHD2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ENTHD2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ENTHD2. This antibody reacts with human. The ENTHD2 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human ENTHD2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LPILLKGTSDDDVPCPGYLFEEIAKISHESPGSSQCLLEYLLSRLHSSSGHGKLKVLKILLYLCSHGSSFFLLILKRNSAFIQEAAAFAGPPDPLHGNSLYQKVR |
|---|
| Other Names | AP-4 Accessory Protein, AP-4 Complex Accessory Subunit Tepsin, C17orf56, Chromosome 17 Open Reading Frame 56, ENTH Domain Containing 2, ENTH Domain-Containing Protein 2, Epsin For AP-4, TEPSIN, TEPSIN, Adaptor Related Protein Complex 4 Accessory Protein, Tetra-Epsin |
|---|
| Gene, Accession # | ENTHD2, Gene ID: 146705 |
|---|
| Catalog # | NBP2-55976 |
|---|
| Price | |
|---|
| Order / More Info | ENTHD2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|