| Edit |   |
|---|
| Antigenic Specificity | SBF1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SBF1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SBF1. This antibody reacts with human. The SBF1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | The immunogen for this antibody is SBF1 - C-terminal region. Peptide sequence YLEPTEDLAPAQEVGEAPSQEDERSALDVASEQRRLWPTLSREKQQELVQ. |
|---|
| Other Names | myotubularin-related protein 5, DENND7A, MTMR5, SET binding factor 1 |
|---|
| Gene, Accession # | SBF1, Gene ID: 6305, Accession: CAH18463, SwissProt: CAH18463 |
|---|
| Catalog # | NBP1-98522-20ul |
|---|
| Price | |
|---|
| Order / More Info | SBF1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|