| Edit |   |
|---|
| Antigenic Specificity | TCF7L1/TCF3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TCF7L1/TCF3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TCF7L1/TCF3. This antibody reacts with human. The TCF7L1/TCF3 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human TCF7L1/TCF3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ALAMNASMSSLVSSRFSPHMVAPAHPGLPTSGIPHPAIVSPIVKQEPAPPSLSPAVSVKSPVTVKKEEEKKPHVKKP |
|---|
| Other Names | HMG box transcription factor 3, TCF3, TCF-3, transcription factor 7-like 1, transcription factor 7-like 1 (T-cell specific, HMG-box) |
|---|
| Gene, Accession # | TCF7L1, Gene ID: 83439 |
|---|
| Catalog # | NBP2-56055 |
|---|
| Price | |
|---|
| Order / More Info | TCF7L1/TCF3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|