| Edit |   |
|---|
| Antigenic Specificity | Calcium Channel, Voltage-Dependent, beta 4 Subunit (CACNB4) (C-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | CACNB4 is a member of the beta subunit family, a protein in the voltage-dependent calcium channel complex. CACNB4 plays an important role in calcium channel function by modulating G protein inhibition, increasing peak calcium current, controlling the alpha-1 subunit membrane targeting and shifting the voltage dependence of activation and inactivation. |
|---|
| Immunogen | CACNB4 antibody was raised using the C terminal of CACNB4 corresponding to a region with amino acids LEAYWRATHTTSSTPMTPLLGRNLGSTALSPYPTAISGLQSQRMRHSNHS |
|---|
| Other Names | CACNB4|CAB4|CACNLB4|EA5|EIG9|EJM|EJM4|EJM6|3110038O15Rik|Cchb4|lethargic|lh |
|---|
| Gene, Accession # | Gene ID: 785 |
|---|
| Catalog # | ABIN633618 |
|---|
| Price | |
|---|
| Order / More Info | Calcium Channel, Voltage-Dependent, beta 4 Subunit (CACNB4) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|