| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TCIRG1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TCIRG1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TCIRG1. This antibody reacts with human, mouse. The TCIRG1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human TCIRG1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RPADRQEENKAGLLDLPDASVNGWSSDEEKAGGLDDEEEAELVPSEVLMHQAIHTI |
|---|
| Other Names | a3, Atp6i, ATP6N1Cspecific 116-kDa vacuolar proton pump subunit, ATP6V0A3T-cell immune response cDNA 7, OC-116, OC-116 kDa, OC-116kDa, OC116Vph1, OPTB1, Osteoclastic proton pump 116 kDa subunit, Stv1, T-cell immune regulator 1, T-cell immune response cDNA7 protein, T-cell, immune regulator 1, T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 protein a, T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 protein A3, T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 protein aisoform 3, T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 subunit A3, TIRC7ATPase, H+ transporting, 116kD, vacuolar proton translocating ATPase 116 kDa subunit A, Vacuolar proton translocating ATPase 116 kDa subunit a isoform 3, V-ATPase 116 kDa isoform a3, V-ATPase 116-kDa, V-type proton ATPase 116 kDa subunit a, V-type proton ATPase 116 kDa subunit a isoform 3 |
|---|
| Gene, Accession # | TCIRG1, Gene ID: 10312 |
|---|
| Catalog # | NBP1-89333 |
|---|
| Price | |
|---|
| Order / More Info | TCIRG1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 22245629 |
|---|
| 产品资料 |
|
|