| Edit |   |
|---|
| Antigenic Specificity | CHAC1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CHAC1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CHAC1. This antibody reacts with human. The CHAC1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to CHAC1(ChaC, cation transport regulator homolog 1 (E. coli)) The peptide sequence was selected from the C terminal of CHAC1. Peptide sequence TPQNPGYLGPAPEEAIATQILACRGFSGHNLEYLLRLADFMQLCGPQAQD. |
|---|
| Other Names | cation transport regulator-like protein 1, ChaC, cation transport regulator homolog 1 (E. coli) |
|---|
| Gene, Accession # | CHAC1, Gene ID: 79094, Accession: Q9BUX1, SwissProt: Q9BUX1 |
|---|
| Catalog # | NBP1-57685 |
|---|
| Price | |
|---|
| Order / More Info | CHAC1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|