| Edit |   |
|---|
| Antigenic Specificity | V-Mos Moloney Murine Sarcoma Viral Oncogene Homolog (MOS) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | MOS is a serine/threonine kinase that activates the MAP kinase cascade through direct phosphorylation of the MAP kinase activator. |
|---|
| Immunogen | MOS antibody was raised using the middle region of MOS corresponding to a region with amino acids LNVARLRHDNIVRVVAASTRTPAGSNSLGTIIMEFGGNVTLHQVIYGAAG |
|---|
| Other Names | MOS|c-mos|msv|p39|mosxe|MSV|p39-mos |
|---|
| Gene, Accession # | Gene ID: 4342 |
|---|
| Catalog # | ABIN634201 |
|---|
| Price | |
|---|
| Order / More Info | V-Mos Moloney Murine Sarcoma Viral Oncogene Homolog (MOS) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|