| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Fc gamma RIIA/CD32a |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Fc gamma RIIA/CD32a Antibody from Novus Biologicals is a rabbit polyclonal antibody to Fc gamma RIIA/CD32a. This antibody reacts with human. The Fc gamma RIIA/CD32a Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human FcgRIIA/CD32a antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RISANSTDPVKAAQFEPPGRQMIAIRKRQLEETNNDYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNSNN |
|---|
| Other Names | CD32 antigen, CD32A, CD32MGC23887, CDw32fc-gamma-RIIa, Fc fragment of IgG, low affinity IIa, receptor (CD32), Fc fragment of IgG, low affinity IIa, receptor for (CD32), FCG2, Fc-gamma RII-a, Fc-gamma-RIIa, FcGR, FCGR2, FCGR2A1, FcRII-a, IGFR2MGC30032, IgG Fc receptor II-a, Immunoglobulin G Fc receptor II, low affinity immunoglobulin gamma Fc region receptor II-a |
|---|
| Gene, Accession # | FCGR2A, Gene ID: 2212 |
|---|
| Catalog # | NBP1-84589 |
|---|
| Price | |
|---|
| Order / More Info | Fc gamma RIIA/CD32a Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|