| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | WDR79 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The WDR79 Antibody from Novus Biologicals is a rabbit polyclonal antibody to WDR79. This antibody reacts with human. The WDR79 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human WDR79 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MKTLETQPLAPDCCPSDQDPAPAHPSPHASPMNKNADSELMPPPPERGDPPRLSPDPVAGSAVSQELREGDPVSLSTPLETEFGSPSELSPRIEEQELSENT |
|---|
| Other Names | FLJ10385, TCAB1WDR79telomerase Cajal body protein 1, WD repeat containing, antisense to TP53, WD repeat domain 79, WD repeat-containing protein 79, WD40 protein Wrap53, WD40 repeat-containing protein encoding RNA antisense to p53, WD-encoding RNA antisense to p53 |
|---|
| Gene, Accession # | WRAP53, Gene ID: 55135 |
|---|
| Catalog # | NBP2-56099 |
|---|
| Price | |
|---|
| Order / More Info | WDR79 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|