| Edit |   |
| Antigenic Specificity | WDR8 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The WDR8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to WDR8. This antibody reacts with human. The WDR8 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to WDR8(WD repeat domain 8) The peptide sequence was selected from the middle region of WDR8. Peptide sequence GCLSFPPPRAGAGPLPSSESKYEIASVPVSLQTLKPVTDRANPKMGIGML. |
| Other Names | FLJ20430, MGC99569, WD repeat domain 8, WD repeat-containing protein 8 |
| Gene, Accession # | WRAP73, Gene ID: 49856, Accession: Q9P2S5, SwissProt: Q9P2S5 |
| Catalog # | NBP1-54776-20ul |
| Price | |
| Order / More Info | WDR8 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |