| Edit |   |
|---|
| Antigenic Specificity | WDR8 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The WDR8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to WDR8. This antibody reacts with mouse. The WDR8 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide towards Wdr8. Peptide sequence RYLALAERRDCRDYVSIFVCSDWQLLRHFDTDTQDLTGIEWAPNGCVLAA. |
|---|
| Other Names | FLJ20430, MGC99569, WD repeat domain 8, WD repeat-containing protein 8 |
|---|
| Gene, Accession # | WRAP73, Gene ID: 49856, Accession: NP_067474 |
|---|
| Catalog # | NBP1-82413 |
|---|
| Price | |
|---|
| Order / More Info | WDR8 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|