| Edit |   |
|---|
| Antigenic Specificity | WDR87 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The WDR87 Antibody from Novus Biologicals is a rabbit polyclonal antibody to WDR87. This antibody reacts with human. The WDR87 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | The specific Immunogen is proprietary information. Peptide sequence PQRELEWDRSQEFFFWHSRVRAISNTEYPKNKEEDEHFLEMRLSKDVTYS. |
|---|
| Other Names | testis development protein NYD-SP11, WD repeat domain 87 |
|---|
| Gene, Accession # | WDR87, Gene ID: 83889, Accession: BAC87627, SwissProt: BAC87627 |
|---|
| Catalog # | NBP1-91510-20ul |
|---|
| Price | |
|---|
| Order / More Info | WDR87 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|