| Edit |   |
|---|
| Antigenic Specificity | WDR89 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The WDR89 Antibody from Novus Biologicals is a rabbit polyclonal antibody to WDR89. This antibody reacts with human. The WDR89 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to WDR89(WD repeat domain 89) The peptide sequence was selected from the middle region of WDR89. Peptide sequence TVRSFCWNVQDDSLLTGGEDAQLLLWKPGAIEKTFTKKESMKIASSVHQR. |
|---|
| Other Names | C14orf150, MGC9907, WD repeat domain 89, WD repeat-containing protein 89 |
|---|
| Gene, Accession # | WDR89, Gene ID: 112840, Accession: Q96FK6, SwissProt: Q96FK6 |
|---|
| Catalog # | NBP1-56333-20ul |
|---|
| Price | |
|---|
| Order / More Info | WDR89 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|