| 产品详情 |
| Edit |   |
| Antigenic Specificity | WDR90 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The WDR90 Antibody from Novus Biologicals is a rabbit polyclonal antibody to WDR90. This antibody reacts with human. The WDR90 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human WDR90 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GFHSLEPWAQLEASDIHTAAAGTHVLTHESAEVPVARTGSCEGFLPDPVLRLKGVIGFGGHGTRQALWTPDGAAVVYPCHAVIVVLLV |
| Other Names | C16orf15, C16orf16, C16orf17, C16orf18, C16orf19, chromosome 16 open reading frame 15, chromosome 16 open reading frame 17, chromosome 16 open reading frame 18, chromosome 16 open reading frame 19, FLJ36483, FLJ44660, KIAA1924chromosome 16 open reading frame 16, WD repeat domain 90, WD repeat-containing protein 90 |
| Gene, Accession # | WDR90, Gene ID: 197335 |
| Catalog # | NBP2-57617 |
| Price | |
| Order / More Info | WDR90 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|