| Edit |   |
|---|
| Antigenic Specificity | Solute Carrier Family 13 Member 2 (SLC13A2) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | SLC13A2 belongs to the SLC13A transporter family, NADC subfamily. It is a multi-pass membrane protein. SLC13A2 cotransports of sodium ions and dicarboxylates such as succinate and citrate. |
|---|
| Immunogen | SLC13 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PNAKGESMVSDGTVAIFIGIIMFIIPSKFPGLTQDPENPGKLKAPLGLLD |
|---|
| Other Names | MUCIN|NADC1|NaCT|NaDC-1|SDCT1|INDY|Nadc1|mNaDC-1|mucin |
|---|
| Gene, Accession # | Gene ID: 9058 |
|---|
| Catalog # | ABIN635937 |
|---|
| Price | |
|---|
| Order / More Info | Solute Carrier Family 13 Member 2 (SLC13A2) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|