| Edit |   |
| Antigenic Specificity | Solute Carrier Family 13 Member 3 (SLC13A3) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | purified |
| Size | 100 µg |
| Concentration | n/a |
| Applications | Western Blotting (WB),Immunohistochemistry (IHC) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Mammalian sodium-dicarboxylate cotransporters transport succinate and other Krebs cycle intermediates. They fall into 2 categories based on their substrate affinity: low affinity and high affinity. Both the low- and high-affinity transporters play an important role in the handling of citrate by the kidneys. SLC13A3 represents the high-affinity form. |
| Immunogen | SLC13 A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids GLSFRGWRKNKSEIRTNAEDRARAVIREEYQNLGPIKFAEQAVFILFCMF |
| Other Names | MGC108337|SLC13A3|zgc:77173|nadc3|sdct2|NADC3|SDCT2|NaDC-3|NaDC3|Nadc3 |
| Gene, Accession # | Gene ID: 64849 |
| Catalog # | ABIN630395 |
| Price | |
| Order / More Info | Solute Carrier Family 13 Member 3 (SLC13A3) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |