| Edit |   |
|---|
| Antigenic Specificity | Solute Carrier Family 22 Member 6 (SLC22A6) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | SLC22A6 is involved in the sodium-dependent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and may be localized to the basolateral membrane. |
|---|
| Immunogen | SLC22 A6 antibody was raised using a synthetic peptide corresponding to a region with amino acids AFNDLLQQVGGVGRFQQIQVTLVVLPLLLMASHNTLQNFTAAIPTHHCRP |
|---|
| Other Names | SLC22A6|OAT1|slc22a6|zgc:77073|Slc22a6|HOAT1|PAHT|ROAT1|NKT|Oat1|Orctl1|mOat1|Paht|Roat1|nkt|oat1|oat1-B|paht|roat1|slc22a6-B |
|---|
| Gene, Accession # | Gene ID: 9356,18399,29509 |
|---|
| Catalog # | ABIN636097 |
|---|
| Price | |
|---|
| Order / More Info | Solute Carrier Family 22 Member 6 (SLC22A6) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|