| Edit |   |
|---|
| Antigenic Specificity | DNA Polymerase epsilon catalytic subunit A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DNA Polymerase epsilon catalytic subunit A Antibody from Novus Biologicals is a rabbit polyclonal antibody to DNA Polymerase epsilon catalytic subunit A. This antibody reacts with human. The DNA Polymerase epsilon catalytic subunit A Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human DNA Polymerase epsilon catalytic subunit A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: HLQRHNHLLWLSPTARPDLGGKEADDNCLVMEFDDQATVEINSSGCYSTVCVELDLQNLAVNTILQSHHVNDMEGADSMGISFDVIQ |
|---|
| Other Names | DKFZp434F222, DNA polymerase epsilon catalytic subunit A, DNA polymerase II subunit A, EC 2.7.7, EC 2.7.7.7, POLE1FLJ21434, polymerase (DNA directed), epsilon |
|---|
| Gene, Accession # | POLE, Gene ID: 5426 |
|---|
| Catalog # | NBP2-55332 |
|---|
| Price | |
|---|
| Order / More Info | DNA Polymerase epsilon catalytic subunit A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|