| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DNA Polymerase epsilon subunit 3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DNA Polymerase epsilon subunit 3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DNA Polymerase epsilon subunit 3. This antibody reacts with human. The DNA Polymerase epsilon subunit 3 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human DNA Polymerase epsilon subunit 3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATS CANNFAMKGKRKTLN |
|---|
| Other Names | Arsenic-transactivated protein, asTP, CHARAC17arsenic transactivated protein, CHRAC-17, CHRAC17Ybl1, Chromatin accessibility complex 17 kDa protein, DNA polymerase epsilon p17 subunit, DNA polymerase epsilon subunit 3, DNA polymerase epsilon subunit p17, DNA polymerase II subunit 3, EC 2.7.7.7, histone fold protein CHRAC17, HuCHRAC17, p17, polymerase (DNA directed), epsilon 3 (p17 subunit), YBL1 |
|---|
| Gene, Accession # | POLE3, Gene ID: 54107 |
|---|
| Catalog # | NBP2-13785 |
|---|
| Price | |
|---|
| Order / More Info | DNA Polymerase epsilon subunit 3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|