| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DNA Polymerase gamma |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DNA Polymerase gamma Antibody from Novus Biologicals is a rabbit polyclonal antibody to DNA Polymerase gamma. This antibody reacts with human. The DNA Polymerase gamma Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human DNA Polymerase gamma antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: FVKGTMKDIRENFQDLMQYCAQDVWATHEVFQQQLPLFLERCPHPVTLAGMLEMGVSYLPVNQNWERYLAEAQGTYEELQREMKKSLMD |
|---|
| Other Names | DNA polymerase subunit gamma-1, EC 2.7.7.7, FLJ27114, MDP1, MIRAS, Mitochondrial DNA polymerase catalytic subunit, MTDPS4A, PolG, catalytic subunit, POLG1MTDPS4B, PolG-alpha, POLGAPEO, polymerase (DNA directed), gamma, SANDO, SCAE |
|---|
| Gene, Accession # | POLG, Gene ID: 5428, Accession: P54098, SwissProt: P54098 |
|---|
| Catalog # | NBP2-33800 |
|---|
| Price | |
|---|
| Order / More Info | DNA Polymerase gamma Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|