| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NOLC1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NOLC1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NOLC1. This antibody reacts with human. The NOLC1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human NOLC1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VPSDLYPLVLGFLRDNQLSEVANKFAKATGATQQDANASSLLDIYSFWLKSAKVPERKLQANGPVAKKAKKK |
|---|
| Other Names | 140 kDa nucleolar phosphoprotein, HCV NS5A trans-regulated protein 13, HCV NS5A-transactivated protein 13, Hepatitis C virus NS5A-transactivated protein 13, KIAA0035NS5ATP13, NOPP130, NOPP140, Nucleolar 130 kDa protein, nucleolar and coiled-body phosphoprotein 1, nucleolar and coiled-body phosphprotein 1, Nucleolar phosphoprotein p130, nucleolar protein p130, P130 |
|---|
| Gene, Accession # | NOLC1, Gene ID: 9221 |
|---|
| Catalog # | NBP1-83058 |
|---|
| Price | |
|---|
| Order / More Info | NOLC1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|