| Edit |   |
|---|
| Antigenic Specificity | Adipocyte Plasma Membrane Associated Protein (APMAP) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | C20orf3 exhibits strong arylesterase activity with beta-naphthyl acetate and phenyl acetate. It may play a role in adipocyte differentiation. |
|---|
| Immunogen | C20 ORF3 antibody was raised using the N terminal Of C20 rf3 corresponding to a region with amino acids EPPLLLGVLHPNTKLRQAERLFENQLVGPESIAHIGDVMFTGTADGRVVK |
|---|
| Other Names | BSCv|C20orf3|C13H20orf3|2310001A20Rik|AI314817|RGD1308874|bscv|cb351|wu:fb50a03|zgc:55833|zgc:85628|APMAP |
|---|
| Gene, Accession # | Gene ID: 57136 |
|---|
| Catalog # | ABIN635470 |
|---|
| Price | |
|---|
| Order / More Info | Adipocyte Plasma Membrane Associated Protein (APMAP) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|