| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DPAGT1 |
|---|
| Clone | 1G1 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | ELISA. It has been used for ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DPAGT1 Antibody (1G1) from Novus Biologicals is a mouse monoclonal antibody to DPAGT1. This antibody reacts with human. The DPAGT1 Antibody (1G1) has been validated for the following applications: ELISA. |
|---|
| Immunogen | DPAGT1 (NP_001373 296 a.a. - 377 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IIPCPRHRIPRLNIKTGKLEMSYSKFKTKSLSFLGTFILKVAESLQLVTVHQSETEDGEFTECNNMTLINLLLKVLGPIHER |
|---|
| Other Names | ALG7, CDG1J, CDG-Ij, D11S366, DGPTDPAGT2UAGT, dolichyl-phosphate (UDP-N-acetylglucosamine)N-acetylglucosaminephosphotransferase 1 (GlcNAc-1-P tra, dolichyl-phosphate (UDP-N-acetylglucosamine)N-acetylglucosaminephosphotransferase 1 (GlcNAc-1-P transferase), dolichyl-phosphate alpha-N-acetylglucosaminyltransferase, EC 2.7.8, EC 2.7.8.15, G1PT, GlcNAc-1-P transferase, GPTDPAGT, N-acetylglucosamine-1-phosphate transferase, UDP-GlcNAc:dolichyl-phosphate N-acetylglucosaminephosphotransferase, UDP-N-acetylglucosamine--dolichyl-phosphateN-acetylglucosaminephosphotransferase, UGAT |
|---|
| Gene, Accession # | DPAGT1, Gene ID: 1798, Accession: NP_001373, SwissProt: NP_001373 |
|---|
| Catalog # | H00001798-M04 |
|---|
| Price | |
|---|
| Order / More Info | DPAGT1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|