| Edit |   |
| Antigenic Specificity | DPCR-1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The DPCR-1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DPCR-1. This antibody reacts with human. The DPCR-1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to DPCR1(diffuse panbronchiolitis critical region 1) The peptide sequence was selected from the C terminal of DPCR1. Peptide sequence SHLNKTEVTHQVPTGSFTLITSRTKLSSITSEATGNESHPYLNKDGSQKG. |
| Other Names | bCX105N19.6, C6orf37, diffuse panbronchiolitis critical region 1, MGC126710, MGC126712, PBLTdiffuse panbronchiolitis critical region 1 protein |
| Gene, Accession # | DPCR1, Gene ID: 135656, Accession: Q3MIW9, SwissProt: Q3MIW9 |
| Catalog # | NBP1-60094 |
| Price | |
| Order / More Info | DPCR-1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |