| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DPH2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DPH2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DPH2. This antibody reacts with human. The DPH2 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human DPH2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DPKAPVVLLSEPACAHALEALATLLRPRYLDLLVSSPAFPQPVGSLSPEP MPLERFGRRFPLAPGRRLEEYGAFYVGGSKASPDPDLDPDLSRL |
|---|
| Other Names | diphthamide biosynthesis protein 2, Diphthamide biosynthesis protein 2 homolog-like 2, diptheria toxin resistance protein required for diphthamide biosynthesis-like 2, diptheria toxin resistance protein required for diphthamide biosynthesis-like 2(S. cerevisiae), DPH2 homolog, DPH2 homolog (S. cerevisiae), DPH2L2diphthamide biosynthesis-like protein 2, DPH2-like 2, DPH2-like 2 (S. cerevisiae), HsDph2 |
|---|
| Gene, Accession # | DPH2, Gene ID: 1802 |
|---|
| Catalog # | NBP2-13933 |
|---|
| Price | |
|---|
| Order / More Info | DPH2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|