| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Rev-erb beta/NR1D2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Rev-erb beta/NR1D2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Rev-erb beta/NR1D2. This antibody reacts with human. The Rev-erb beta/NR1D2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Rev-erb beta/NR1D2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SAMKTMMNSQFSGHLQNDTLVEHHEQTALPAQEQLRPKPQLEQENIKSSSPPSSDFAKEEVIGMVTRAHKDTFMYNQEQQENSAESMQPQRGERIPKN |
|---|
| Other Names | BD73, EAR-1r, HZF2, nuclear receptor subfamily 1 group D member 2, nuclear receptor subfamily 1, group D, member 2, Orphan nuclear hormone receptor BD73, rev-erba-alpha-related receptor, rev-erb-beta, RVR, V-erbA-related protein 1-related |
|---|
| Gene, Accession # | NR1D2, Gene ID: 9975 |
|---|
| Catalog # | NBP2-47306 |
|---|
| Price | |
|---|
| Order / More Info | Rev-erb beta/NR1D2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|