| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CDC42SE1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. IF fixation/permeabilization: PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CDC42SE1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CDC42SE1. This antibody reacts with human. The CDC42SE1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human CDC42SE1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LGCCVVEKPQPKKKRRRIDRTMIGEPMNFVHLTHIGSGEMGAGDGLAMTGAVQEQMRSKGNR |
|---|
| Other Names | 1300002M12Rik, CDC42 small effector 1, CDC42-binding protein SCIP1, SCIP1, signaling molecule SPEC1 beta, Small effector of CDC42 protein 1, small protein effector 1 of Cdc42, SPEC1CDC42 small effector protein 1 |
|---|
| Gene, Accession # | CDC42SE1, Gene ID: 56882, Accession: Q9NRR8, SwissProt: Q9NRR8 |
|---|
| Catalog # | NBP1-80780 |
|---|
| Price | |
|---|
| Order / More Info | CDC42SE1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|