| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CDC42SE2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CDC42SE2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CDC42SE2. This antibody reacts with human, mouse, rat. The CDC42SE2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat CDC42SE2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EPTNFVHTAHVGSGDLFSGMNSVSSIQNQMQSKGGYGGGMPANVQMQLVDTKAG |
|---|
| Other Names | CDC42 small effector 2, FLJ21967, non-kinase Cdc42 effector protein SPEC2, Small effector of CDC42 protein 2, SPEC2CDC42 small effector protein 2 |
|---|
| Gene, Accession # | CDC42SE2, Gene ID: 56990 |
|---|
| Catalog # | NBP1-82131 |
|---|
| Price | |
|---|
| Order / More Info | CDC42SE2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|