| Edit |   |
|---|
| Antigenic Specificity | MB21D2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MB21D2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MB21D2. This antibody reacts with human. The MB21D2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the C terminal of human C3orf59. Peptide sequence QSDGGDPNQPDDRLAKKLQQLVTENPGKSISVFINPDDVTRPHFRIDDKF. |
|---|
| Other Names | C3orf59, chromosome 3 open reading frame 59, hypothetical protein LOC151963, Mab-21 domain containing 2, Mab-21 domain-containing protein 2 |
|---|
| Gene, Accession # | MB21D2, Gene ID: 151963, Accession: NP_848591, SwissProt: NP_848591 |
|---|
| Catalog # | NBP1-79527 |
|---|
| Price | |
|---|
| Order / More Info | MB21D2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|