| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MBD1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100 |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MBD1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MBD1. This antibody reacts with human. The MBD1 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PGCPSKAVDPGLPSVKQEPPDPEEDKEENKDDSASKLAPEEEAGGAGTPVITEIFSLGGTRFRDTAVWLPRSK |
|---|
| Other Names | CXXC-type zinc finger protein 3, methyl-CpG binding domain protein 1, methyl-CpG binding domain protein 1 isoform PCM1, methyl-CpG-binding domain protein 1, Methyl-CpG-binding protein MBD1, PCM1CXXC3RFT, Protein containing methyl-CpG-binding domain 1, the regulator of fibroblast growth factor 2 (FGF-2) transcription |
|---|
| Gene, Accession # | MBD1, Gene ID: 4152 |
|---|
| Catalog # | NBP2-68876 |
|---|
| Price | |
|---|
| Order / More Info | MBD1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|