| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TRAF-4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TRAF-4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TRAF-4. This antibody reacts with human. The TRAF-4 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human TRAF-4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GAFDNLLEWPFARRVTFSLLDQSDPGLAKPQHVTETFHPDPNWKNFQKPGTWRGSLDESSLGFGYPKFISHQDIRKRNYVRDDAVFIRAAVELPRKI |
|---|
| Other Names | CART1RING finger protein 83, Cysteine-rich domain associated with RING and Traf domains protein 1, Metastatic lymph node gene 62 protein, MLN 62, MLN62cysteine-rich domain associated with ring and TRAF domain, RNF83malignant 62, TNF receptor-associated factor 4, tumor necrosis receptor-associated factor 4A |
|---|
| Gene, Accession # | TRAF4, Gene ID: 9618, Accession: Q9BUZ4, SwissProt: Q9BUZ4 |
|---|
| Catalog # | NBP2-33647 |
|---|
| Price | |
|---|
| Order / More Info | TRAF-4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|