| Edit |   |
| Antigenic Specificity | MMD2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The MMD2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MMD2. This antibody reacts with human. The MMD2 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to MMD2(monocyte to macrophage differentiation-associated 2) The peptide sequence was selected from the N terminal of MMD2. Peptide sequence FAPRLLDFQKTKYARFMNHRVPAHKRYQPTEYEHAANCATHAFWIIPSIL. |
| Other Names | FLJ37205, monocyte to macrophage differentiation factor 2, monocyte to macrophage differentiation-associated 2, monocyte-to-macrophage differentiation factor 2, PAQR10Progestin and adipoQ receptor family member 10, Progestin and adipoQ receptor family member X |
| Gene, Accession # | MMD2, Gene ID: 221938, Accession: Q8IY49, SwissProt: Q8IY49 |
| Catalog # | NBP1-56388-20ul |
| Price | |
| Order / More Info | MMD2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |