| Edit |   |
|---|
| Antigenic Specificity | KLHL35 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human (antigen sequence identity: mouse 89%, rat 87%) |
|---|
| Isotype | n/a |
|---|
| Format | antigen affinity purified |
|---|
| Size | 100 µl |
|---|
| Concentration | n/a |
|---|
| Applications | ICC-IF, IHC |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit anti-human KLHL35 polyclonal antibody. |
|---|
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: KLFVIGGARQGGVNTDKVQCFDPKEDRWSLRSPAPFSQRCLEAVSLEDTIYVMGGLMSKIFT |
|---|
| Other Names | kelch-like family member 35, FLJ33790 |
|---|
| Gene, Accession # | Gene ID: 283212, UniProt: Q6PF15, ENSG00000149243 |
|---|
| Catalog # | HPA039864 |
|---|
| Price | |
|---|
| Order / More Info | KLHL35 Antibody from ATLAS ANTIBODIES AB |
|---|
| Product Specific References | n/a |
|---|