| Edit |   |
|---|
| Antigenic Specificity | SH2D3A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SH2D3A Antibody from Novus Biologicals is a rabbit polyclonal antibody to SH2D3A. This antibody reacts with human. The SH2D3A Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human SH2D3A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: WRQLRRSHTEAALAFEQELKPLMRALDEGAGPCDPGEVALPHVAPMVRLLEGEEVAGPLDESCERLLRTLHGARHMVRDAPKFRKVAAQRLRGFRPN |
|---|
| Other Names | Novel SH2-containing protein 1, NSP1SH2 domain-containing 3A, SH2 domain containing 3A, SH2 domain-containing protein 3A |
|---|
| Gene, Accession # | SH2D3A, Gene ID: 10045 |
|---|
| Catalog # | NBP2-57054 |
|---|
| Price | |
|---|
| Order / More Info | SH2D3A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|