| Edit |   |
| Antigenic Specificity | KLHL9 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 100%, rat 100%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 µl |
| Concentration | n/a |
| Applications | IHC |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human KLHL9 polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: RYQHGIAVIGNFLYVVGGQSNYDTKGKTAVDTVFRFDPRYNKWMQVASLNE |
| Other Names | kelch-like family member 9, FLJ13568, KIAA1354 |
| Gene, Accession # | Gene ID: 55958, UniProt: Q9P2J3, ENSG00000198642 |
| Catalog # | HPA046039 |
| Price | |
| Order / More Info | KLHL9 Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |