| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Delta(4)-Desaturase, Sphingolipid 1 (DEGS1) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | DEGS1 is a member of the membrane fatty acid desaturase family which is responsible for inserting double bonds into specific positions in fatty acids. This protein contains three His-containing consensus motifs that are characteristic of a group of membrane fatty acid desaturases. It is predicted to be a multiple membrane-spanning protein localized to the endoplasmic reticulum. Overexpression of this protein inhibited biosynthesis of the EGF receptor, suggesting a possible role of a fatty acid desaturase in regulating biosynthetic processing of the EGF receptor. |
|---|
| Immunogen | DEGS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GSRVSREDFEWVYTDQPHADRRREILAKYPEIKSLMKPDPNLIWIIIMMV |
|---|
| Other Names | AA536663|Degs|Des1|Mdes|degs|im:6909319|wu:fa25h01|wu:fb81d06|DES1|DEGS|DEGS-1|Des-1|FADS7|MLD |
|---|
| Gene, Accession # | Gene ID: 8560,13244,58970 |
|---|
| Catalog # | ABIN635423 |
|---|
| Price | |
|---|
| Order / More Info | Delta(4)-Desaturase, Sphingolipid 1 (DEGS1) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|