| Edit |   |
|---|
| Antigenic Specificity | Chromosome 22 Open Reading Frame 28 (C22orf28) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | C22ORF28 is believed to be involved in vinculin binding. |
|---|
| Immunogen | C22 ORF28 antibody was raised using the N terminal Of C22 rf28 corresponding to a region with amino acids PEAVVSPGGVGFDINCGVRLLRTNLDESDVQPVKEQLAQAMFDHIPVGVG |
|---|
| Other Names | C1H22orf28|c22orf28|C10H22orf28|MGC154502|C22orf28|HSPC117|AI255213|AI463255|FAAP|DJ149A16.6|RP1-149A16.6 |
|---|
| Gene, Accession # | Gene ID: 51493 |
|---|
| Catalog # | ABIN632911 |
|---|
| Price | |
|---|
| Order / More Info | Chromosome 22 Open Reading Frame 28 (C22orf28) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|