| Edit |   |
| Antigenic Specificity | Chromosome 6 Open Reading Frame 201 (C6orf201) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 µg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The specific function of C6orf201 is not yet known. |
| Immunogen | C6 ORF201 antibody was raised using the N terminal Of C6 rf201 corresponding to a region with amino acids PFGMGLGNTSRSTDAPSQSTGDRKTGSVGSWGAARGPSGTDTVSGQSNSG |
| Other Names | dJ1013A10.5 |
| Gene, Accession # | Gene ID: 404220 |
| Catalog # | ABIN633387 |
| Price | |
| Order / More Info | Chromosome 6 Open Reading Frame 201 (C6orf201) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |