| Edit |   |
|---|
| Antigenic Specificity | Chromosome 7 Open Reading Frame 42 (C7orf42) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The function of C7orf42 protein has not been widely studied, and is yet to be fully elucidated. |
|---|
| Immunogen | C7 ORF42 antibody was raised using the N terminal Of C7 rf42 corresponding to a region with amino acids FSINPLENLKVYISSRPPLVVFMISVSAMAIAFLTLGYFFKIKEIKSPEM |
|---|
| Other Names | MGC79534|C7orf42|TMEM248|c7orf42|C25H7orf42|0610007L01Rik|A930023A16Rik|AW557951|G430067H08Rik |
|---|
| Gene, Accession # | Gene ID: 55069 |
|---|
| Catalog # | ABIN635459 |
|---|
| Price | |
|---|
| Order / More Info | Chromosome 7 Open Reading Frame 42 (C7orf42) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|