| Edit |   |
| Antigenic Specificity | Chromosome X Open Reading Frame 66 (CXorf66) (Middle Region) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 µg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The protein encoded by this gene is predicted to be a type I membrane protein, however, its exact function is not known. |
| Immunogen | CXorf66 antibody was raised using the middle region of CXorf66 corresponding to a region with amino acids PLYSSHPQNEISPSKPFGPQELAKPPKHFNPKRSVSLGRAALLSNSELAE |
| Other Names | n/a |
| Gene, Accession # | Gene ID: 347487 |
| Catalog # | ABIN635057 |
| Price | |
| Order / More Info | Chromosome X Open Reading Frame 66 (CXorf66) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |