| 产品详情 |
| Edit |   |
| Antigenic Specificity | Solute Carrier Family 27 (Fatty Acid Transporter), Member 2 (SLC27A2) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 µg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | SLC27A2 is an isozyme of long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme activates long-chain, branched-chain and very-long-chain fatty acids containing 22 or more carbons to their CoA derivatives. It is expressed primarily in liver and kidney, and is present in both endoplasmic reticulum and peroxisomes, but not in mitochondria. Its decreased peroxisomal enzyme activity is in part responsible for the biochemical pathology in X-linked adrenoleukodystrophy. |
| Immunogen | SLC27 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLFRDETLTYAQVDRRSNQVARALHDHLGLRQGDCVALLMGNEPAYVWLW |
| Other Names | vlcs|fatp2|vlacs|acsvl1|facvl1|im:7139614|slc27a2|wu:fb99g05|zgc:112376|fatp6|acsvl2|facvl2|vlcs-h1|ACSVL1|FACVL1|FATP2|HsT17226|VLACS|VLCS|hFACVL1|Vlac|Vlacs |
| Gene, Accession # | Gene ID: 11001,26458,65192 |
| Catalog # | ABIN635835 |
| Price | |
| Order / More Info | Solute Carrier Family 27 (Fatty Acid Transporter), Member 2 (SLC27A2) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |
| 产品资料 |
|
|