| Edit |   |
|---|
| Antigenic Specificity | Solute Carrier Family 27 (Fatty Acid Transporter), Member 6 (SLC27A6) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | SLC27A6 is a member of the fatty acid transport protein family (FATP). FATPs are involved in the uptake of long-chain fatty acids and have unique expression patterns. Alternatively spliced transcript variants encoding the same protein have been found for this gene. |
|---|
| Immunogen | SLC27 A6 antibody was raised using a synthetic peptide corresponding to a region with amino acids KSTCLYIFTSGTTGLPKAAVISQLQVLRGSAVLWAFGCTAHDIVYITLPL |
|---|
| Other Names | zgc:153783|ACSVL2|FACVL2|FATP6|VLCS-H1|4732438L20Rik |
|---|
| Gene, Accession # | Gene ID: 28965,225579,291582 |
|---|
| Catalog # | ABIN635364 |
|---|
| Price | |
|---|
| Order / More Info | Solute Carrier Family 27 (Fatty Acid Transporter), Member 6 (SLC27A6) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|