| Edit |   |
|---|
| Antigenic Specificity | Solute Carrier Family 46 (Folate Transporter), Member 1 (SLC46A1) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | This gene encodes a transmembrane proton-coupled folate transporter protein that facilitates the movement of folate and antifolate substrates across cell membranes optimally in acidic pH environments. |
|---|
| Immunogen | SLC46 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MEGSASPPEKPRARPAAAVLCRGPVEPLVFLANFALVLQGPLTTQYLWHR |
|---|
| Other Names | G21|HCP1|PCFT|RGD1309472|TRPE|1110002C08Rik|D11Ertd18e|Pcft |
|---|
| Gene, Accession # | Gene ID: 113235,52466,303333 |
|---|
| Catalog # | ABIN635109 |
|---|
| Price | |
|---|
| Order / More Info | Solute Carrier Family 46 (Folate Transporter), Member 1 (SLC46A1) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|