| Edit |   |
| Antigenic Specificity | Solute Carrier Family 37 (Glucose-6-Phosphate Transporter), Member 4 (SLC37A4) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 µg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | SLC37A4 transports glucose-6-phosphate from the cytoplasm to the lumen of the endoplasmic reticulum. It forms with glucose-6-phosphatase the complex responsible for glucose production through glycogenolysis and gluconeogenesis. Hence, it plays a central role in homeostatic regulation of blood glucose levels. |
| Immunogen | SLC37 A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids VSFLCLLLIHNEPADVGLRNLDPMPSEGKKGSLKEESTLQELLLSPYLWV |
| Other Names | G6PC|MGC68695|g6pt1|g6pt2|g6pt3|gsd1b|gsd1c|gsd1d|trg19|pro0685|MGC97640|G6PT1|G6PT2|G6PT3|GSD1b|GSD1c|GSD1d|TRG-19|TRG19|G6PT|G6pt1|GSD-1b|mG6PT |
| Gene, Accession # | Gene ID: 2542 |
| Catalog # | ABIN634867 |
| Price | |
| Order / More Info | Solute Carrier Family 37 (Glucose-6-Phosphate Transporter), Member 4 (SLC37A4) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |