| Edit |   |
|---|
| Antigenic Specificity | Fatty Acid Amide Hydrolase 2 (FAAH2) (C-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Fatty acid amide hydrolases, such as FAAH1 and FAAH2, hydrolyze primary fatty acid amide substrates and may play a role in fatty acid catabolism. |
|---|
| Immunogen | FAAH2 antibody was raised using the C terminal of FAAH2 corresponding to a region with amino acids SPLWELIKWCLGLSVYTIPSIGLALLEEKLRYSNEKYQKFKAVEESLRKE |
|---|
| Other Names | AMDD |
|---|
| Gene, Accession # | Gene ID: 158584 |
|---|
| Catalog # | ABIN636114 |
|---|
| Price | |
|---|
| Order / More Info | Fatty Acid Amide Hydrolase 2 (FAAH2) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|