| Edit |   |
|---|
| Antigenic Specificity | THO Complex 6 Homolog (Drosophila) (THOC6) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | THOC6 belongs to the WD repeat THOC6 family.It contains 7 WD repeats. The function of the THOC6 protein remains unknown. |
|---|
| Immunogen | THOC6 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGGDCQLHTMDLETGTFTRVLRGHTDYIHCLALRERSPEVLSGGEDGAVR |
|---|
| Other Names | zgc:101618|WDR58|fSAP35|F830014G06Rik|Wdr58|Pdrp |
|---|
| Gene, Accession # | Gene ID: 79228,386612,79227 |
|---|
| Catalog # | ABIN631845 |
|---|
| Price | |
|---|
| Order / More Info | THO Complex 6 Homolog (Drosophila) (THOC6) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|